PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr028978.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 260aa    MW: 29740.5 Da    PI: 8.5599
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr028978.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.45.9e-171259148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT++Ed +lv+ v ++G ++W+ Ia+  g++Rt+k+c++rw +yl
      Pbr028978.1 12 RGPWTEQEDFQLVCFVGLFGDRRWDFIAKVSGLNRTGKSCRLRWVNYL 59
                     89********************************************97 PP

2Myb_DNA-binding54.62.5e-1765110148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T++E+ l ++++ ++G++ W++Iar+++ gRt++++k++w++++
      Pbr028978.1  65 RGKMTPQEERLVLELHSKWGNR-WSRIARKLP-GRTDNEIKNYWRTHM 110
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.656759IPR017930Myb domain
SuperFamilySSF466893.67E-2910106IPR009057Homeodomain-like
SMARTSM007175.0E-151161IPR001005SANT/Myb domain
PfamPF002491.4E-151259IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.8E-201366IPR009057Homeodomain-like
CDDcd001673.66E-101459No hitNo description
PROSITE profilePS5129427.83560114IPR017930Myb domain
SMARTSM007177.6E-1764112IPR001005SANT/Myb domain
PfamPF002491.0E-1565109IPR001005SANT/Myb domain
CDDcd001672.30E-1167110No hitNo description
Gene3DG3DSA:1.10.10.605.4E-2467113IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MKMVQDQEQI RRGPWTEQED FQLVCFVGLF GDRRWDFIAK VSGLNRTGKS CRLRWVNYLH  60
PDLKRGKMTP QEERLVLELH SKWGNRWSRI ARKLPGRTDN EIKNYWRTHM RKKAQEKKRA  120
MSPSSSSSNC SSSSNITITE GGESFYDTGG RKTKASSGGK KTGGGDEVKE DEKREQREYS  180
LDDIWKDINL PEVSSIVPVY DGNLSSCPLM ASPTPWEYCS DSLWKMDLEE ESKIMFLPTP  240
SGDHQFLSCY EYGKASLTG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-28121144105MYB PROTO-ONCOGENE PROTEIN
1h88_C1e-27911455159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-27911455159MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-28121144105C-Myb DNA-Binding Domain
1msf_C2e-28121144105C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1157164GGKKTGGG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009338346.10.0PREDICTED: transcription factor MYB59-like isoform X1
SwissprotQ9LX822e-87MYB48_ARATH; Transcription factor MYB48
TrEMBLM5W1561e-130M5W156_PRUPE; Uncharacterized protein (Fragment)
STRINGVIT_06s0004g04140.t011e-107(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF43783359
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46130.14e-81myb domain protein 48